Protein coding transcript 239555

• Transcript: Ll_transcript_58559
• CDS coordinates: 161-826 (+)
• Peptide sequence: MKPILMFLTMFLLLFLLLSTAESKCTQGCSLALASYYMNPNSTLTSISQVMSSELLKVPEDIVTYNKDTIPNKDSVQAFIRVNVPFPCDCIDGEFLGHKFQYDVKTKDTYQIIAETEYANLTTVDWLKKFNTYPDNNIPDTATLDVTVNCSCGDKNVLNYGLFITYPLRPGETLDSVSKSVNLTSGLLQSYNPGVNFSKGSGLVYIPGKDQNGSYVFLNSR*
• ORF Type: complete

Annotations of Ll_transcript_58559

• Blastp: LysM domain receptor-like kinase 3 from Medicago with 49.08% of identity
• Blastx: Chitin elicitor receptor kinase 1 from Oryza sativa with 69.28% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g086130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425563.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;