Protein coding transcript 239564

• Transcript: Ll_transcript_58571
• CDS coordinates: 79-738 (+)
• Peptide sequence: MFLVDKSKCTQGCPTALASYYMFNGSDLTYISQIMSSYLLHSPEDIVSYNKDTITNKDKVEAFTRVNVPFPCECIEGEFLGHRFQYVVQKGDTYETVAGTNYANLINVEWLMRFNTYPADSIPSTGILNVTVNCSCGNSDVSDYELFITYPLRPGETLGSVASSVKLDSGLLQRYNPSVNFNQGSGLVYIPGKDQNGSYVFLSSSSGGLIFSLLSILVM*
• ORF Type: complete

Annotations of Ll_transcript_58571

• Blastp: LysM domain receptor-like kinase 3 from Medicago with 50% of identity
• Blastx: Chitin elicitor receptor kinase 1 from Oryza sativa with 86.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_5g086130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455827.1)
• Pfam: LysM domain (PF01476.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;