Transcript | Ll_transcript_365366 |
---|---|
CDS coordinates | 126-641 (+) |
Peptide sequence | MEEQGSSNMNTKQHHNQGTTTTTNNNNAYVDTTKAERAVWLLKCPSMVSRSLRSSPSDDPSLPIAKVVLSIDPLNSNDDDSPQFTMELAGTEAGNIPKCYDMDMTTDFIPMSVFSDTPQGKISVEGKILNKFDMRPRNQSLELYGKLCRERTNKYMVKNRQIQVMTLVQWF* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | General transcription factor IIF subunit 2 from Xenopus with 41.79% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459446.1) |
Pfam | Transcription initiation factor IIF, beta subunit (PF02270.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer