Protein coding transcript 239611

• Transcript: Ll_transcript_56053
• CDS coordinates: 60-407 (+)
• Peptide sequence: MVSPISLVLLFSVFVFVVNVDGGNIPTTLDGPFKPLTVPLDNTFRGHAVDLPHTDPLLQRTVQGSEPEQISLSLSASYHSLWISWITGLIFIMLLLYHLPNQTNQPVFFFVIKIY*
• ORF Type: complete

Annotations of Ll_transcript_56053

• Blastp: Purple acid phosphatase 15 from Arabidopsis with 66.15% of identity
• Blastx: Purple acid phosphatase 15 from Arabidopsis with 66.15% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT3G07130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417888.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;