Transcript | Ll_transcript_56053 |
---|---|
CDS coordinates | 60-407 (+) |
Peptide sequence | MVSPISLVLLFSVFVFVVNVDGGNIPTTLDGPFKPLTVPLDNTFRGHAVDLPHTDPLLQRTVQGSEPEQISLSLSASYHSLWISWITGLIFIMLLLYHLPNQTNQPVFFFVIKIY* |
ORF Type | complete |
Blastp | Purple acid phosphatase 15 from Arabidopsis with 66.15% of identity |
---|---|
Blastx | Purple acid phosphatase 15 from Arabidopsis with 66.15% of identity |
Eggnog | Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409) |
Kegg | Link to kegg annotations (AT3G07130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417888.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer