Protein coding transcript 239612

• Transcript: Ll_transcript_56048
• CDS coordinates: 1-1020 (+)
• Peptide sequence: LKFSNFFKQLIDTQLFFFFLVLTLSLLQSSNSCPKFLFLQKLHLKTILSLPQNFTFTLISMGPTYVLLLLLCLILLSSIPSHSVNIHPQEKTSLLTFKSWLQDPNQSLSNWVASNSNCTSWTGTTCDNITGKVVSINLTNMNLSGQINPSFCHLLSLIKVVLSHNNFTCPIPVCFGKLLSLRTIDLSHNRFHGEIPNSFIRLKYLTELVLNENSDLGGLLPSWIGSFSANLERIDLSFSSFSGGIPESLLYLKSLKYLNLENNLLSGNLVDFYQSMVFINLASNRFSGTLPCFAASAESLNMLNLSNNSIVGGIPACIASFKALTHLNLSGNHLRYRISP
• ORF Type: internal

Annotations of Ll_transcript_56048

• Blastp: Leucine-rich repeat receptor-like protein CLAVATA2 from Arabidopsis with 58.59% of identity
• Blastx: Leucine-rich repeat receptor-like protein CLAVATA2 from Arabidopsis with 58.59% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G65380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462112.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;