Protein coding transcript 239626

• Transcript: Ll_transcript_56448
• CDS coordinates: 3-407 (+)
• Peptide sequence: PPTPKHSSPPTPTHSSPPTPKHSPSPKAPSPTPKQSPSPKAPSPSPTKQPSCPNDILKFDVCADVLGLVNVQLGKSSKDQCCSLIDGLSNLDAAVCLCTALKANVLGINLNVPINLSLILNYCGKDVPNGFQCA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_56448

• Blastp: pEARLI1-like lipid transfer protein 1 from Arabidopsis with 67.06% of identity
• Blastx: pEARLI1-like lipid transfer protein 1 from Arabidopsis with 66.67% of identity
• Eggnog: 14 kDa proline-rich protein(ENOG410YRRT)
• Kegg: Link to kegg annotations (AT4G12470)
• CantataDB: Link to cantataDB annotations (CNT0000401)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446706.1)
• Pfam: Hydrophobic seed protein (PF14547.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;