Protein coding transcript 239628

• Transcript: Ll_transcript_56472
• CDS coordinates: 55-465 (+)
• Peptide sequence: MASKAALLLSLNILFFTVVSSTYVPCPPPPTPKHTSHPKAPSSNPAYPKKQPSCPKDTLKLGVCADVLGLVNAKLGKPPKVPCCSLIDGLANLEAAVCLCTALKANVLGINLNIPINLSLILNYCGKGVPNGFQCA*
• ORF Type: complete

Annotations of Ll_transcript_56472

• Blastp: 14 kDa proline-rich protein DC2.15 from Daucus sect. Daucus with 60% of identity
• Blastx: 14 kDa proline-rich protein DC2.15 from Daucus sect. Daucus with 73.49% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000401)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446705.1)
• Pfam: Hydrophobic seed protein (PF14547.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;