Transcript | Ll_transcript_365377 |
---|---|
CDS coordinates | 126-938 (+) |
Peptide sequence | MEEQGSSNMNTKQHHNQGTTTTTNNNNAYVDTTKAERAVWLLKCPSMVSRSLRSSPSDDPSLPIAKVVLSIDPLNSNDDDSPQFTMELAGTEAGNIPKCYDMDMTTDFIPMSVFSDTPQGKISVEGKILNKFDMRPRNQSLELYGKLCRERTNKYMVKNRQIQVIDNDNGAHMRPMPGMIIMASAPSDKKKTPARGTEMKRTRRDRGEMEEIVFKLFERQSNWSLRNLIQETDQPEQFLKDILKDLCVYNNKGANQGTYELKPEYRKSGD* |
ORF Type | complete |
Blastp | General transcription factor IIF subunit 2 from Sophophora with 26.46% of identity |
---|---|
Blastx | General transcription factor IIF subunit 2 from Bos with 30.77% of identity |
Eggnog | factor iif(COG5090) |
Kegg | Link to kegg annotations (Dmel_CG6538) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459446.1) |
Pfam | Transcription initiation factor IIF, beta subunit (PF02270.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer