Protein coding transcript 23965

• Transcript: Ll_transcript_365381
• CDS coordinates: 126-761 (+)
• Peptide sequence: MEEQGSSNMNTKQHHNQGTTTTTNNNNAYVDTTKAERAVWLLKCPSMVSRSLRSSPSDDPSLPIAKVVLSIDPLNSNDDDSPQFTMELAGTEAGNIPKCYDMDMTTDFIPMSVFSDTPQGKISVEGKILNKFDMRPRNQSLELYGKLCRERTNKYMVKNRQIQVIDNDNGAHMRPMPGMIIMASAPSVNGLFFILTNFSLSNVFFFLLLMR*
• ORF Type: complete

Annotations of Ll_transcript_365381

• Blastp: -
• Blastx: General transcription factor IIF subunit 2 from Xenopus with 41.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459446.1)
• Pfam: Transcription initiation factor IIF, beta subunit (PF02270.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;