Protein coding transcript 239778

• Transcript: Ll_transcript_58333
• CDS coordinates: 1-534 (+)
• Peptide sequence: QHLRDDGLLHTTCGSPNYVAPEVLANKGYDGATSDAWSCGVILYVILTGYLPFDDRNMAVLYQKIFKGDVQIPKWLSCGAQNMIKRILDPNPKTRITMTQIKEDQWFKEDYTPAIPYEDEDEENIDIDNEALSIHEVPHEAEERSPRASTLINAFQLIGMSSCLDLSNFFLKEDVSER
• ORF Type: internal

Annotations of Ll_transcript_58333

• Blastp: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 70.22% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 70.79% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G17510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455784.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;