Protein coding transcript 239780

• Transcript: Ll_transcript_58338
• CDS coordinates: 1-417 (+)
• Peptide sequence: QHLRDDGLLHTTCGSPNYVAPEVLANKGYDGATSDAWSCGVILYVILTGYLPFDDRNMAVLYQKIFKGDVQIPKWLSCGAQNMIKRILDPNPKTRITMTQIKEDQWFKEDYTPAIPYEDEDEENIDIDNEALSIHEVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_58338

• Blastp: CBL-interacting protein kinase 17 from Oryza sativa with 72.36% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 78.45% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4337736)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455784.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;