Protein coding transcript 239789

• Transcript: Ll_transcript_58348
• CDS coordinates: 466-951 (+)
• Peptide sequence: MAVLYQKIFKGDVQIPKWLSPGAQNMIKRVLDPNPKTRITMAEIKEDPWFKEDYNPANPEEDEEEDINNIDNATLSIMEVPHEAEERSPRSPTLINAFQLIGMSSCLDLSNFFEKEDVSERKIRFTSNLSAKDLTQRIEDIVTEMGFKVQNKNGNVSILYH*
• ORF Type: complete

Annotations of Ll_transcript_58348

• Blastp: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 61.39% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 69.71% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G17510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420055.1)
• Pfam: NAF domain (PF03822.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;