Transcript | Ll_transcript_56937 |
---|---|
CDS coordinates | 145-729 (+) |
Peptide sequence | MASSICNKLFMTSSSSFECHSDPDFSASPRFENLRRRKNVSPTTTSFYPLSSLIFRFPPNFHRQLSTKARRNCSNIGVAQIVAASWSNSDANVAASPVTSPAAASAVDAAIPPLSVAPAEIDNDVVVVVSDEGGNGNGVVQANGSVDQLSYSSFLKSDGSLTIHAGTSQSFNRLISISITRFFVLFGSIWIWIR* |
ORF Type | complete |
Blastp | Cystathionine gamma-synthase 1, chloroplastic from Arabidopsis with 61.04% of identity |
---|---|
Blastx | Cystathionine gamma-synthase 1, chloroplastic from Arabidopsis with 60.26% of identity |
Eggnog | cystathionine(COG0626) |
Kegg | Link to kegg annotations (AT3G01120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427881.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer