Protein coding transcript 239912

• Transcript: Ll_transcript_56939
• CDS coordinates: 1500-2060 (+)
• Peptide sequence: MNQKALALGADLVVHSATKYIAGHNDVIAGTVSGSLTLVSEVRKLHHVLGGTLNPNAAYLIIRGMKTLALRVQQQNSTGLRMAKVLEAHPKVKHVYYPALQNHPEHELAKRQMTGFGGVVSFEIDGDLATTAKFIDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQSERAKYGIHDNLVRFSFGIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_56939

• Blastp: Cystathionine gamma-synthase 1, chloroplastic from Arabidopsis with 86.1% of identity
• Blastx: Cystathionine gamma-synthase 1, chloroplastic from Arabidopsis with 72.18% of identity
• Eggnog: cystathionine(COG0626)
• Kegg: Link to kegg annotations (AT3G01120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427881.1)
• Pfam: Cys/Met metabolism PLP-dependent enzyme (PF01053.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;