Protein coding transcript 239928

• Transcript: Ll_transcript_57125
• CDS coordinates: 197-1309 (+)
• Peptide sequence: MVCEKYGGRVELAKAYYKALTNSVRKHFKGNGVIASMEHCNDFMLLGTEAISLGRVGDDFWCTDPYGDPNGTFWLQGCHMVHCAYNSLWMGNFIHPDWDMFQSTHPCAAFHAASRAISGGPIYISDTVGNHNFELLKTLVLPDGTILRCEHYALPTKDSLFSDPLHDGKTMLKIWNLNKYTGVIGVFNCQGGGWFRETRTNKCASEFSHLVSTNTNIKDIEWNRAKNPISIEGVQLFALYFSQGNKLVLSSPSDSEEISLEPFNFELITVSPVTFLHGKSSSSVVQFAPIGLVNMLNTGGAIQSLAFDEAKNLVEVGVRGKGEMRVFASEKPSTCRIDGEEVHFQYESNMVVIQVPWPSSSKLSNVHYIF*
• ORF Type: complete

Annotations of Ll_transcript_57125

• Blastp: Galactinol--sucrose galactosyltransferase from Pisum with 71.89% of identity
• Blastx: Galactinol--sucrose galactosyltransferase from Pisum with 71.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442543.1)
• Pfam: Raffinose synthase or seed imbibition protein Sip1 (PF05691.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;