Protein coding transcript 23993

• Transcript: Ll_transcript_390609
• CDS coordinates: 382-1122 (+)
• Peptide sequence: MIRWLYYLLLLPLGVWCAIGLLGCEMNCLSALDVIHHLVNNHVTLYVLLQDILDLAKHATVPVINGLTDYNHPCQIMADALTMIEHIGQLEGTKVVYVGDGNNIVHSWLLLASVIPFHFVCACPKGFEPDEKTVEKARKAGISKIEITNDPKEAVRGADVVYSDVWASMGQKEEAAYRRQVFKGFQVDKSLMDIAGSKAFFMHCLPAERGVEVTDEVVEASNSIVFQQAENRLHAQNSIMLHVLGK*
• ORF Type: complete

Annotations of Ll_transcript_390609

• Blastp: Ornithine carbamoyltransferase, chloroplastic from Pisum with 89.85% of identity
• Blastx: Ornithine carbamoyltransferase, chloroplastic from Pisum with 89.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458808.1)
• Pfam: Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;