Protein coding transcript 239950

• Transcript: Ll_transcript_57605
• CDS coordinates: 904-1632 (+)
• Peptide sequence: MHLVKLIGYYEDRCQQLLVYEYLPNGNVGNHLYDSEGLPLGRLDLWRRLSIALGAAKGLEHLHSLVPPLVHTNFRTRNVLLDENYTAKVSDYGFFKMQRKADQPGSSSNIDCFLDPELRLSQNYSEHSDVYSFGVFLLELISGCEAHNKNMSNPYETLVFQAKKHNNGVDNFVDMTLGEHEKCNGARNMMKLALLCVDVSYRRPSMRQIVQELEHIQREIAHLYSQFSEEIGVVTLGSELFQ*
• ORF Type: complete

Annotations of Ll_transcript_57605

• Blastp: Probable serine/threonine-protein kinase PBL9 from Arabidopsis with 39.01% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 34.57% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G07570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447876.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;