Transcript | Ll_transcript_57619 |
---|---|
CDS coordinates | 642-1697 (+) |
Peptide sequence | MRIKRLIRQTSETASSMPSPSVEMGRGNNSEYVSAFTPHYSQKTRHITILELEQATRNFGQSNIIGEGGFGLVYKGLLEDGSIVAIKRRQFALTPDFVREVKQITHTHHMHLVKLIGYYEDRCQQLLVYEYLPNGNVGNHLYDSEGLPLGRLDLWRRLSIALGAAKGLEHLHSLVPPLVHTNFRTRNVLLDENYTAKVSDYGFFKMQRKADQPGSSSNIDCFLDPELRLSQNYSEHSDVYSFGVFLLELISGCEAHNKNMSNPYETLVFQAKKHNNGVDNFVDMTLGEHEKCNGARNMMKLALLCVDVSYRRPSMRQIVQELEHIQREIAHLYSQFSEEIGVVTLGSELFQ* |
ORF Type | complete |
Blastp | Probable serine/threonine-protein kinase PBL9 from Arabidopsis with 35.95% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase PBL9 from Arabidopsis with 35.95% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G07570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447876.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer