Protein coding transcript 239954

• Transcript: Ll_transcript_57619
• CDS coordinates: 642-1697 (+)
• Peptide sequence: MRIKRLIRQTSETASSMPSPSVEMGRGNNSEYVSAFTPHYSQKTRHITILELEQATRNFGQSNIIGEGGFGLVYKGLLEDGSIVAIKRRQFALTPDFVREVKQITHTHHMHLVKLIGYYEDRCQQLLVYEYLPNGNVGNHLYDSEGLPLGRLDLWRRLSIALGAAKGLEHLHSLVPPLVHTNFRTRNVLLDENYTAKVSDYGFFKMQRKADQPGSSSNIDCFLDPELRLSQNYSEHSDVYSFGVFLLELISGCEAHNKNMSNPYETLVFQAKKHNNGVDNFVDMTLGEHEKCNGARNMMKLALLCVDVSYRRPSMRQIVQELEHIQREIAHLYSQFSEEIGVVTLGSELFQ*
• ORF Type: complete

Annotations of Ll_transcript_57619

• Blastp: Probable serine/threonine-protein kinase PBL9 from Arabidopsis with 35.95% of identity
• Blastx: Probable serine/threonine-protein kinase PBL9 from Arabidopsis with 35.95% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G07570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447876.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;