Protein coding transcript 239956

• Transcript: Ll_transcript_57590
• CDS coordinates: 248-931 (+)
• Peptide sequence: MMTMRLLWRLRLPLLILIQLLYPNKSTYKLYAEALFTIKSSQQFGCNIVNYPCQIQWPCLDCNKIKDPGAITRKIDGNNDIPTLTPLQDSQAKRPEGIKGAVIVGAIVASLIVVTILVIVYICLMRIKRLIRQTSETASSMPSPSVEMGRGNNSEYVSAFTPHYSQKTRHITILELEQATRNFGQSNIIGEGGFGLVYKGLLEDGSIVAIKRRQFALTPDFVREVNM*
• ORF Type: complete

Annotations of Ll_transcript_57590

• Blastp: Probable receptor-like protein kinase At5g24010 from Arabidopsis with 30.3% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 40.76% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G24010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447876.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;