Transcript | Ll_transcript_57590 |
---|---|
CDS coordinates | 248-931 (+) |
Peptide sequence | MMTMRLLWRLRLPLLILIQLLYPNKSTYKLYAEALFTIKSSQQFGCNIVNYPCQIQWPCLDCNKIKDPGAITRKIDGNNDIPTLTPLQDSQAKRPEGIKGAVIVGAIVASLIVVTILVIVYICLMRIKRLIRQTSETASSMPSPSVEMGRGNNSEYVSAFTPHYSQKTRHITILELEQATRNFGQSNIIGEGGFGLVYKGLLEDGSIVAIKRRQFALTPDFVREVNM* |
ORF Type | complete |
Blastp | Probable receptor-like protein kinase At5g24010 from Arabidopsis with 30.3% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 40.76% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G24010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447876.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer