Transcript | Ll_transcript_57568 |
---|---|
CDS coordinates | 3-1340 (+) |
Peptide sequence | LSIAKMKNKLQLYQELQSQLKESQRALGEAISDAELNHSAHEKMKSMGQVLSKSKDQLYDCKLVTVKLRAMLQTADEQVRSLKKQSTFLSQLAAKTIPNGIHCLSMRLTIDYYLLAPEKRKFPMSQNLENPGLYHYALFSDNVLAASVVVNSTVLNAKDPSKHVFHVVTDKLNFGAMNMWFLLNPPGKATIHVENVDDFKWLNSSYCPVLRQLESATMKEYYFKAGHSTSLSNGASNLKYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWALNLNGKVNGAVETCGESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVLWKLGTLPPGLITFYGLTHPLNKLWHVLGLGYNPSVDRTEIENAAVVHYNGNMKPWLEIAMTKYHSYWTKYVKYNHPYVQNCKLIE* |
ORF Type | 5prime_partial |
Blastp | Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 85.33% of identity |
---|---|
Blastx | Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 85.33% of identity |
Eggnog | Alpha-1,4-galacturonosyltransferase(ENOG4111FC1) |
Kegg | Link to kegg annotations (AT3G61130) |
CantataDB | Link to cantataDB annotations (CNT0001702) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461204.1) |
Pfam | Glycosyl transferase family 8 (PF01501.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer