Protein coding transcript 240006

• Transcript: Ll_transcript_57544
• CDS coordinates: 666-1865 (+)
• Peptide sequence: MKSMGQVLSKSKDQLYDCKLVTVKLRAMLQTADEQVRSLKKQSTFLSQLAAKTIPNGIHCLSMRLTIDYYLLAPEKRKFPMSQNLENPGLYHYALFSDNVLAASVVVNSTVLNAKDPSKHVFHLVTDKLNFGAMNMWFLLNPPGKATIHVENVDEFKWLNSSYCPVLKQLESAAMKEYYFKAGHSTTGASNLKYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVNLHGKVNGAVETCGESFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQSMNEDRVLWKLGTLPPGLMTFYGLTHPLNKSWHVLGLGYNPTVDRSEIDNAAVIHYNGNMKPWLEIAMTKYRPYWTKYVKYNHPYVQNCKLIE*
• ORF Type: complete

Annotations of Ll_transcript_57544

• Blastp: Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 86.97% of identity
• Blastx: Polygalacturonate 4-alpha-galacturonosyltransferase from Arabidopsis with 87.13% of identity
• Eggnog: Alpha-1,4-galacturonosyltransferase(ENOG4111FC1)
• Kegg: Link to kegg annotations (AT3G61130)
• CantataDB: Link to cantataDB annotations (CNT0001701)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461204.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;