Protein coding transcript 240024

• Transcript: Ll_transcript_56583
• CDS coordinates: 1056-1832 (+)
• Peptide sequence: MMCSDLMILNICFYSVMFLFCPETRTLSQNNLTGTIPESLASLPSLINVLLDSNDLSGQIPDQLFKVSKYNFTGNKLNCGMNQRHPCAFDSADQGSSHKPKTGLIIGVIVGLAVILFLCCLLFFWCKGSHRGYKPEVFVDVAGEVDRRIAFGQLKRFAWRELQIATDNFSEKNVLGQGGFGKVYKGVLADNTKVAVKRLTDYESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTPTERLLVYPFMQNLSVAYRLRGI*
• ORF Type: complete

Annotations of Ll_transcript_56583

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At5g65240 from Arabidopsis with 73.82% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 64.95% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G65240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459678.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;