Protein coding transcript 240028

• Transcript: Ll_transcript_56587
• CDS coordinates: 1348-2676 (+)
• Peptide sequence: MLIVKHLSCSSLQGNGITGGIPKEIGNLTNLNRLDLENNRLTGEIPSSLGNLKRLQFLTLSQNNLTGTIPESLASIPSLINVLLDSNYLSGQIPDPLFEVSKYNFTGNNLNCGVNHRHPCASDNADQGSSHKSKTGLVIGVIVGVVVILFLCGLLCFWFKGRHKGYKREIFVDVAGEVDRRIAFGQLKRFAWRELQIATDNFSEKNVLGQGGFGKVYKGVLADNTKVAVKRLTDYESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTPTERLLVYPFMQNLSVAYRLREIKPGEPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGVMLLELVTGQRAIDFSRLEEEDDVLLLDHVNLFLYQCLISSCVSVCFLFL*
• ORF Type: complete

Annotations of Ll_transcript_56587

• Blastp: LRR receptor kinase SERK2 from Oryza sativa with 74.77% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 80.38% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4329032)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464538.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;