Protein coding transcript 240034

• Transcript: Ll_transcript_56573
• CDS coordinates: 2140-2979 (+)
• Peptide sequence: MIFFVLLFLVLLGEVDRRIAFGQLKRFAWRELQIATDNFSEKNVLGQGGFGKVYKGVLADNTKVAVKRLTDYESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTPTERLLVYPFMQNLSVAYRLREIKPGEPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGVMLLELVTGQRAIDFSRLEEEDDVLLLDHVNLFLYQCLISSCVSVCFLFL*
• ORF Type: complete

Annotations of Ll_transcript_56573

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 92.49% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 94.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464538.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;