Protein coding transcript 240035

• Transcript: Ll_transcript_56594
• CDS coordinates: 244-759 (+)
• Peptide sequence: MPVKMDFIFVLFLLGCLCSFVLPDSQGDALFALRSSLNASANQLTDWNQNQVNPCTWSRVYCDQNYNVLQVSLAFMGFTGTLTPRIGVLKYLKTLSLQGNGITGGIPKEIGNLTNLNRLDLENNRLTGEIPSSLGNLKRLQFLTLSQNNLTGTIPESLASIPSLINVYVKF*
• ORF Type: complete

Annotations of Ll_transcript_56594

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 65.81% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At5g10290 from Arabidopsis with 65.81% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464538.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;