Protein coding transcript 240091

• Transcript: Ll_transcript_56837
• CDS coordinates: 1197-2378 (+)
• Peptide sequence: MNRQPGAVIGSPGPGRTKKIFVGGLPSTITESEFKQYFDQFGTITDVVVMYDHNTQRPRGFGFITYDSEDAVNRVLYKTFHELNGKMVEVKMAVPKELSPGPSRSPLIGYNFGLNRASSYLNSYAQGFNMNPLGGYGVKMDGRFSPLSTGRSGFNQIGSGGYGMGMNFGSGLSPIYGGTSNYGSGLGYGRIFSPFYNGNNSSRYTTPIGYSGDNTRSDSLLNSTSHNVWGNGSLSNTTNSQVNPGAYLGSGSGNFGVSIGNSGTNWSPSVPSQGGGAAASGFTNWSNVYEGGGDGNIGLGGVVYGRNRNPNVTQSTSFAAPASGYEGSYGNLYHSGSVYSDSTWRSAASEIDGSSSFGYGLGGIASEDPVKTSEGFIGNYNVTSRQPNRGIAA*
• ORF Type: complete

Annotations of Ll_transcript_56837

• Blastp: RNA-binding protein 1 from Arabidopsis with 68.29% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 42.05% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT1G58470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456443.1)
• Pfam: RNA recognition motif (PF16367.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;