Transcript | Ll_transcript_56838 |
---|---|
CDS coordinates | 444-812 (+) |
Peptide sequence | MESDLGKLFIGGISWDTDEERLKEYFGKYGEVIEAVIMRDRTTGRARGFGFVVFADPAVAERVIMDKHIIDGRTVEAKKAVPRDDQNAINRQPGGVLGSPGPGRTKKIFVGGLPSTITENDFK |
ORF Type | 3prime_partial |
Blastp | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 53.12% of identity |
---|---|
Blastx | Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 53.12% of identity |
Eggnog | Rna-binding protein(ENOG410YA8Z) |
Kegg | Link to kegg annotations (AT4G14300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460541.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer