Transcript | Ll_transcript_55986 |
---|---|
CDS coordinates | 200-838 (+) |
Peptide sequence | MEGIMQVPYQTTTKLMLASLERNLLPDPIIRRITRLLLASRLRSCAKPSSQLQLDDFIQFVHSLQEMPIAIDTDKAKSQHYELPTSFFKLVLGENLKYSSCYFSSPSKTLEEAEEAMLELYCERSKLKDGHTVLDIGCGWGSLPLYIAKKYSNSRVTGICNSTTQKAYIEERIRDLQLQNLDIIVADIRTFEMERSFDRIISIEMFEVGVCE* |
ORF Type | complete |
Blastp | (S)-coclaurine N-methyltransferase from Thalictrum with 47.54% of identity |
---|---|
Blastx | (S)-coclaurine N-methyltransferase from Thalictrum with 48.28% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAU20766) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417540.1) |
Pfam | Mycolic acid cyclopropane synthetase (PF02353.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer