Protein coding transcript 240158

• Transcript: Ll_transcript_57434
• CDS coordinates: 801-1268 (+)
• Peptide sequence: MRLSSAGFSPPPLEGEKRCLDSELWHACAGPLVSLPAVGSRVFYFPQGHSEQVAVSTNKEVDAHIPNYPSLPPQLICQLHNLTMHADAETDEVYAQMTLQPLNPVCNPVLTVNDFITFLVIFILKPFYHDVVFSKSKRKRTFQQSWALRVNSQQTT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_57434

• Blastp: Auxin response factor 6 from Arabidopsis with 87.62% of identity
• Blastx: Auxin response factor 6 from Arabidopsis with 87.62% of identity
• Eggnog: auxin response factor(ENOG410YA3R)
• Kegg: Link to kegg annotations (AT1G30330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419302.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;