Transcript | Ll_transcript_55921 |
---|---|
CDS coordinates | 228-551 (+) |
Peptide sequence | MEEQNGSSKFSTGLRKLKPYLAMVSLQFGYSGMYIITMVSFKHGMSHWILSVYRHVIAAILIIPFALLLERKIRPKMTLPIFLRIVALGFLEPVLDQNLYNMGMKMTS |
ORF Type | 3prime_partial |
Blastp | WAT1-related protein At4g08300 from Arabidopsis with 76.84% of identity |
---|---|
Blastx | WAT1-related protein At4g08300 from Arabidopsis with 76.84% of identity |
Eggnog | Auxin-induced protein(ENOG410YBPN) |
Kegg | Link to kegg annotations (AT4G08300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020225531.1) |
Pfam | EamA-like transporter family (PF00892.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer