Protein coding transcript 24019

• Transcript: Ll_transcript_390220
• CDS coordinates: 1011-1670 (+)
• Peptide sequence: MLEPGKGNGQNETTISVDLEKASSFTDNDTEQSTGSDKYPAPSTPQLKQGARLLDDGDCQEQTICSTEKESSELDGESKSVETTCGNLNAQSTSQQRESEKIPVKKEDDLANQSKDESGNAVSSHPCNVKVQSKADSNRKSPKKVGVLSNSCEKKGNRKKMKVDWTPELHKKFVRAVEQLGIEHAIPSRILELMKVEDLTRHNVASHLQKYRMHKRHILP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_390220

• Blastp: Two-component response regulator-like APRR2 from Arabidopsis with 48.99% of identity
• Blastx: Two-component response regulator-like APRR2 from Arabidopsis with 46.67% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT4G18020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430481.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;