Transcript | Ll_transcript_55853 |
---|---|
CDS coordinates | 3-989 (+) |
Peptide sequence | QPSRAMKLPLLLTTPLFLLFSLIQGNNNPNCDAQDHGSTLQVFHVFSPCSPFKPTKTLSWEESVLQLQAKDQLRMQYLSNLVAGRSVVPIASGRQIIQNPTYIVRARFGTPSQTLLLAMDTSNDAAWVPCTGCVGCSSIAPFAPAKSISFKNVGCGAPQCKQVPNPTCSGSACSFNLTYGSSAVAANLVQDRLTLATDPIPAYTFGCIQQTTGTSVPAQGLLGLGRGPLSLLAQTQNLYQSTFSYCLPSFKTLNFSGSLRLGPVQPNKLKFTPLLKNPRRSSLYYVNLVAVKVGRKIVDIPPAALALNPTTGAGTIFDSGNVLRFIYF* |
ORF Type | 5prime_partial |
Blastp | Aspartyl protease AED3 from Arabidopsis with 49.19% of identity |
---|---|
Blastx | Aspartyl protease AED3 from Arabidopsis with 49.19% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AT1G09750) |
CantataDB | Link to cantataDB annotations (CNT0002310) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449311.1) |
Pfam | Xylanase inhibitor N-terminal (PF14543.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer