Protein coding transcript 240229

• Transcript: Ll_transcript_55853
• CDS coordinates: 3-989 (+)
• Peptide sequence: QPSRAMKLPLLLTTPLFLLFSLIQGNNNPNCDAQDHGSTLQVFHVFSPCSPFKPTKTLSWEESVLQLQAKDQLRMQYLSNLVAGRSVVPIASGRQIIQNPTYIVRARFGTPSQTLLLAMDTSNDAAWVPCTGCVGCSSIAPFAPAKSISFKNVGCGAPQCKQVPNPTCSGSACSFNLTYGSSAVAANLVQDRLTLATDPIPAYTFGCIQQTTGTSVPAQGLLGLGRGPLSLLAQTQNLYQSTFSYCLPSFKTLNFSGSLRLGPVQPNKLKFTPLLKNPRRSSLYYVNLVAVKVGRKIVDIPPAALALNPTTGAGTIFDSGNVLRFIYF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_55853

• Blastp: Aspartyl protease AED3 from Arabidopsis with 49.19% of identity
• Blastx: Aspartyl protease AED3 from Arabidopsis with 49.19% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT1G09750)
• CantataDB: Link to cantataDB annotations (CNT0002310)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449311.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;