Protein coding transcript 240236

• Transcript: Ll_transcript_57953
• CDS coordinates: 213-773 (+)
• Peptide sequence: MNKLKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKDGLKRVGSNLMESEIKSLMEAADIDNSGTIDYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQASKDFGLSDVHLEDMIKEIDTDNDGRIDYGEFAAMMKKGDPDMGRSRTMKGNLNFNIADAFGVKEDSS*
• ORF Type: complete

Annotations of Ll_transcript_57953

• Blastp: Calcium-dependent protein kinase 4 from Arabidopsis with 84.95% of identity
• Blastx: Calcium-dependent protein kinase 4 from Arabidopsis with 83.64% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT4G09570)
• CantataDB: Link to cantataDB annotations (CNT0002419)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452731.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;