Transcript | Ll_transcript_57955 |
---|---|
CDS coordinates | 1-1161 (+) |
Peptide sequence | GGELFDRIIQKGHYSEKEAVKLIKTIVGVVEACHSLGVIHRDLKPENFLFDTPGEDAMMKATDFGLSVFYKPGQYFHDVVGSPYYVAPEVLCKQYGPHVDVWSAGVILYIILSGVPPFWAETEAGIFKQILHGEVDFASEPWPNISESAKDLVKKMLDRDPTRRISAHEVLCHPWIVDDTVAPDKPLDSAVLTRLKHFSAMNKLKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFKELKNGLKRVGSNLMESEIKSLMEAADIDNSGTIDYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQASKDFGLTDLHLDDMIKEIDTDNDGRIDYGEFAAMMKKGDSDMGRSRSMKGNLNFNIADAFAAKEDSS* |
ORF Type | 5prime_partial |
Blastp | Calcium-dependent protein kinase 4 from Arabidopsis with 81.09% of identity |
---|---|
Blastx | Calcium-dependent protein kinase 4 from Arabidopsis with 81.09% of identity |
Eggnog | calcium-dependent protein kinase(ENOG410XRMJ) |
Kegg | Link to kegg annotations (AT4G09570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427945.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer