Transcript | Ll_transcript_57964 |
---|---|
CDS coordinates | 1558-2076 (+) |
Peptide sequence | MKQFRAMNKLKKIAMKVMAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLARIGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHKHRLERDEHLYKAFQYFDKDNSGYITRDELEVAMTKYGMGDEATIKEIISEVDTDNDGRINYEEFCVMMRSGMQHQGPLL* |
ORF Type | complete |
Blastp | Calcium-dependent protein kinase 21 from Arabidopsis with 82.08% of identity |
---|---|
Blastx | Calcium-dependent protein kinase 2 from Zea with 83.68% of identity |
Eggnog | calcium-dependent protein kinase(ENOG410XRMJ) |
Kegg | Link to kegg annotations (AT4G04720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419664.1) |
Pfam | EF-hand domain pair (PF13833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer