Protein coding transcript 240246

• Transcript: Ll_transcript_57964
• CDS coordinates: 1558-2076 (+)
• Peptide sequence: MKQFRAMNKLKKIAMKVMAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLARIGSKLSEAEVKQLMEAADVDGNGSIDYIEFISATMHKHRLERDEHLYKAFQYFDKDNSGYITRDELEVAMTKYGMGDEATIKEIISEVDTDNDGRINYEEFCVMMRSGMQHQGPLL*
• ORF Type: complete

Annotations of Ll_transcript_57964

• Blastp: Calcium-dependent protein kinase 21 from Arabidopsis with 82.08% of identity
• Blastx: Calcium-dependent protein kinase 2 from Zea with 83.68% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT4G04720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419664.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;