Protein coding transcript 240247

• Transcript: Ll_transcript_57965
• CDS coordinates: 406-795 (+)
• Peptide sequence: MLIDFILFYMLYACYLQKNYFQVIAERLSEEEIGGLKELFKMIDTDNSGTITFKELKNGLKRVGSNLMESEIKSLMEAADIDNSGTIDYGEFLAATLHLNKMEREENLVAAFAYFDKDGSGYITIDELQQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_57965

• Blastp: Calcium-dependent protein kinase 11 from Arabidopsis with 89.47% of identity
• Blastx: Calcium-dependent protein kinase 4 from Arabidopsis with 88.7% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT1G35670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452731.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;