Protein coding transcript 240251

• Transcript: Ll_transcript_57948
• CDS coordinates: 1-477 (+)
• Peptide sequence: GGELFDRIIQKGHYSEKEAVKLIKTIVGVVEACHSLGVIHRDLKPENFLFDTPGEDAMMKATDFGLSVFYKPGQYFHDVVGSPYYVAPEVLCKQYGPHVDVWSAGVILYILLSGVPPFWAETEAGIFKQILHGELDFKSEPWPNIPEIAKDSVKKMLDR
• ORF Type: internal

Annotations of Ll_transcript_57948

• Blastp: Calcium-dependent protein kinase 11 from Arabidopsis with 81.76% of identity
• Blastx: Calcium-dependent protein kinase 11 from Arabidopsis with 81.76% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT1G35670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427945.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;