Transcript | Ll_transcript_57948 |
---|---|
CDS coordinates | 1-477 (+) |
Peptide sequence | GGELFDRIIQKGHYSEKEAVKLIKTIVGVVEACHSLGVIHRDLKPENFLFDTPGEDAMMKATDFGLSVFYKPGQYFHDVVGSPYYVAPEVLCKQYGPHVDVWSAGVILYILLSGVPPFWAETEAGIFKQILHGELDFKSEPWPNIPEIAKDSVKKMLDR |
ORF Type | internal |
Blastp | Calcium-dependent protein kinase 11 from Arabidopsis with 81.76% of identity |
---|---|
Blastx | Calcium-dependent protein kinase 11 from Arabidopsis with 81.76% of identity |
Eggnog | calcium-dependent protein kinase(ENOG410XRMJ) |
Kegg | Link to kegg annotations (AT1G35670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427945.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer