Protein coding transcript 240253

• Transcript: Ll_transcript_57950
• CDS coordinates: 1-318 (+)
• Peptide sequence: EHPWIREGGEASDKPIDSAVLSRMKQFRAMNKLKKIAMKVMAENLSEEEIKGLKAMFANMDTDNSGTITYEELKTGLARIGSKLSEAEVKQLMEAVSNNITLPNS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_57950

• Blastp: Calcium-dependent protein kinase from Daucus sect. Daucus with 80.77% of identity
• Blastx: Calcium-dependent protein kinase from Daucus sect. Daucus with 80.77% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419664.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;