Protein coding transcript 2403

• Transcript: Ll_transcript_428101
• CDS coordinates: 3-410 (+)
• Peptide sequence: YLGEKYDYDITEARKIWCFGPDGIGPNMLLDCTKGVQYLNEIKDSVVAGFQWATKEGVLSEENMRGVRFNIYDVTLHTDAIHRGGGQIIPTTRRCLYASQLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGH
• ORF Type: internal

Annotations of Ll_transcript_428101

• Blastp: Elongation factor 2 from Sophophora with 88.24% of identity
• Blastx: Elongation factor 2 from Sophophora with 88.24% of identity
• Eggnog: Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post- translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity)(COG0480)
• Kegg: Link to kegg annotations (Dmel_CG2238)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013467256.1)
• Pfam: Elongation factor G, domain IV (PF03764.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;