Protein coding transcript 240360

• Transcript: Ll_transcript_258481
• CDS coordinates: 259-687 (+)
• Peptide sequence: MFRETYNAITKGNPMWNNLSVPSGSLYAWDTESTYIHEPPYFKDMSMSPPGAHGVKNAYCLLNFGDSITTDHISPAGSIHKDSPAARYLVEHGVDRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTLHIPSGEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_258481

• Blastp: Putative aconitate hydratase, cytoplasmic from Oryza sativa with 86.71% of identity
• Blastx: Putative aconitate hydratase, cytoplasmic from Oryza sativa with 76.86% of identity
• Eggnog: aconitate hydratase(COG1048)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423390.1)
• Pfam: Aconitase C-terminal domain (PF00694.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;