Protein coding transcript 240361

• Transcript: Ll_transcript_258482
• CDS coordinates: 1-465 (+)
• Peptide sequence: KMFVDYSEPQVERVYSSYLELNLEDVDPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFAVPKESQNKVAEFTFNGTPAHLKHADVVIAAITSCTNTSNPSVMLGAALVAKKACEFGLQVKPWIKTSLAPGSGVVTKYLQRRYSLKCSESI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_258482

• Blastp: Aconitate hydratase, cytoplasmic from Cucurbita with 83.33% of identity
• Blastx: Aconitate hydratase 1 from Arabidopsis with 69.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000366)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421114.1)
• Pfam: Aconitase family (aconitate hydratase) (PF00330.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;