Protein coding transcript 240500

• Transcript: Ll_transcript_259595
• CDS coordinates: 1728-2408 (+)
• Peptide sequence: MLSHSIGQIMGSESWHSNVDVPEDILALSNECSDNLRKMEPLQVLKLLPSCSDDSNKKPGLGLSSSQFRERRKVQLVEQPGQKTGSRSPQAATTRPVTQGRPMSADDIQKAKMRALFMQSKYGKTGPAKESKGAKINGLNKPQTNQASISACSSKVPLPLKIEEDKKSPPLPSKITSRSEASYSNLKMDLKEPLWEKCKRVQIPWKTPAGTFATFLLVPSNICLQY*
• ORF Type: complete

Annotations of Ll_transcript_259595

• Blastp: Homeobox protein LUMINIDEPENDENS from Arabidopsis with 51.75% of identity
• Blastx: Homeobox protein LUMINIDEPENDENS from Arabidopsis with 64.36% of identity
• Eggnog: homeobox protein(ENOG4111YQX)
• Kegg: Link to kegg annotations (AT4G02560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440851.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;