Protein coding transcript 240513

• Transcript: Ll_transcript_259606
• CDS coordinates: 1-372 (+)
• Peptide sequence: PVCNFALMVGTTDIPDWCYVEALGTVARNCFTKAPSAEDLALFYSKSPISHSSKVKTPILFLLGAKDLRVPLSDGLQYARALKEKGVEVKVIMFQNDVHALKRPQSDFECFLNIGVWFNKYCK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_259606

• Blastp: Acylamino-acid-releasing enzyme from Arabidopsis with 70.73% of identity
• Blastx: Acylamino-acid-releasing enzyme from Arabidopsis with 70.73% of identity
• Eggnog: peptidase s9 prolyl oligopeptidase active site domain protein(COG1506)
• Kegg: Link to kegg annotations (AT4G14570)
• CantataDB: Link to cantataDB annotations (CNT0002022)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449928.1)
• Pfam: Dienelactone hydrolase family (PF01738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;