Transcript | Ll_transcript_259278 |
---|---|
CDS coordinates | 636-1115 (+) |
Peptide sequence | MRYSTSLIGGPATLATFVAVYALFGPTYPGVYDRERGVYTLFYPGLSFAFPIPSQYTECCHNGGVELPLEFPDGTTPVTCRVSIYDSSSGKKVGVGSLMDKASAPPLPPGSIYMEEVHVKLGEELYFTVGTQHIPFGASPQDVWTELGRPCGIHQKQVP* |
ORF Type | complete |
Blastp | UPF0183 protein At3g51130 from Arabidopsis with 83.54% of identity |
---|---|
Blastx | UPF0183 protein At3g51130 from Arabidopsis with 83.72% of identity |
Eggnog | Chromosome 16 open reading frame 70(ENOG410XT40) |
Kegg | Link to kegg annotations (AT3G51130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422128.1) |
Pfam | Uncharacterised protein family (UPF0183) (PF03676.13) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer