Protein coding transcript 240565

• Transcript: Ll_transcript_259237
• CDS coordinates: 2550-3029 (+)
• Peptide sequence: MRYSTSLIGGPANLATFVAVYALFGPTYPGVYDGERGVYTLIYPGLSFAFPIPSQYTECCHNEEVELPLEFPDGTTPVTCRVSIYDSSSGKKVGVGSLMDKASAPPLPVGSIYMEEVHVKLGGELYFTVGTQLIPFGASPQDVWTELGRPCGIHQKQVP*
• ORF Type: complete

Annotations of Ll_transcript_259237

• Blastp: UPF0183 protein At3g51130 from Arabidopsis with 81.01% of identity
• Blastx: UPF0183 protein At3g51130 from Arabidopsis with 79.33% of identity
• Eggnog: Chromosome 16 open reading frame 70(ENOG410XT40)
• Kegg: Link to kegg annotations (AT3G51130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422531.1)
• Pfam: Uncharacterised protein family (UPF0183) (PF03676.13)
• Rfam: -
• GO: -