Protein coding transcript 240646

• Transcript: Ll_transcript_257831
• CDS coordinates: 60-1073 (+)
• Peptide sequence: MAASSHSAMAFPGFKLLKYLVVFTCVMIGVCSADELRNNFYDKTCPKMIRTIKFAVDDAVHRERRMGASLLRLHFHDCFVQGCDGSVLLDDTPNFTGEKNSFPNANSLRGFEVIDDIKSQLEDMCPGVVSCADILAVAASEAVGILGGQRWNVLLGRRDSTTASLSEANSDIPAPFLDLNGLISTFSKKGFTAEEMVTLSGAHTIGLVRCRFFRDRIYNETNIDPSFAAAMKEVCPFDDGDDNLAPFDSKTPMFFDNAYYRNLVESKGLVHSDQQLFVDGSRQTNPQVIAYSRNFGRFKHDFANAMFKMSQLSPLTGYDGQIRTNCHFINPTTDEYK*
• ORF Type: complete

Annotations of Ll_transcript_257831

• Blastp: Cationic peroxidase 1 from Arachis with 65.22% of identity
• Blastx: Cationic peroxidase 1 from Arachis with 66.45% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435182.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;