Protein coding transcript 240693

• Transcript: Ll_transcript_257923
• CDS coordinates: 111-506 (+)
• Peptide sequence: MPWNTLMDRMMMELHSHEKTIEDIVKVLQKIPIHPRVIPAIKSAHALGCELRVVSDANMFFIETILKHLGIRECFTEINSNPGYVDEEGKLRILPYHDFTKSSHGCSLCPPNMCKGLIIDRIQSSISPEENK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_257923

• Blastp: Inorganic pyrophosphatase 2 from Arabidopsis with 76.74% of identity
• Blastx: Inorganic pyrophosphatase 2 from Arabidopsis with 79.19% of identity
• Eggnog: Phosphatase(ENOG4111NAQ)
• Kegg: Link to kegg annotations (AT1G17710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448203.1)
• Pfam: Putative Phosphatase (PF06888.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;