Transcript | Ll_transcript_257925 |
---|---|
CDS coordinates | 2-430 (+) |
Peptide sequence | FTHLFNDLLHTMPWNSLMDRMMMELYSQGVTIEDIVKVLHRIPIHPRIIPALKAAHALGCDMRIVSDANLFFIETILKHLGIRECFTEINSNPGYVDEEGKLRILPYHDFTKSSHGCSLCPPNMCKGLIIDRIQSSISPEENK |
ORF Type | internal |
Blastp | Inorganic pyrophosphatase 2 from Arabidopsis with 73.57% of identity |
---|---|
Blastx | Inorganic pyrophosphatase 2 from Arabidopsis with 73.57% of identity |
Eggnog | Phosphatase(ENOG4111NAQ) |
Kegg | Link to kegg annotations (AT1G17710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448203.1) |
Pfam | Putative Phosphatase (PF06888.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer