Protein coding transcript 24075

• Transcript: Ll_transcript_391219
• CDS coordinates: 3-500 (+)
• Peptide sequence: IIHHDIANEIPVHAQRLQYSAFASWLGIVLCLVFNVVAVIVCWVRGGGVKIFFLAVIYTLLGVPLSYVLWYRPLYRAMRTDSALKFSWFFLFYLLHIAFCIFAAIAPPIVFHGNSLTGILAAIGLFSDHVLVGIFYLVGFGLFCLESILSLWVLQKTYMYFRGHK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_391219

• Blastp: Secretory carrier-associated membrane protein 4 from Arabidopsis with 80% of identity
• Blastx: Secretory carrier-associated membrane protein 4 from Arabidopsis with 80% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (AT1G32050)
• CantataDB: Link to cantataDB annotations (CNT0002201)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421870.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;