Protein coding transcript 24080

• Transcript: Ll_transcript_391213
• CDS coordinates: 2-352 (+)
• Peptide sequence: RGGGVKIFFLAVIYTLLGVPLSYVLWYRPLYRAMRTDSALKFTWFFLFYLLHIAFCIFAAIAPPVVFHGKSLTGILAAIDVFSDHVLVGIFYLVGFGLFCLESLLSLWVLQKIYMYF
• ORF Type: internal

Annotations of Ll_transcript_391213

• Blastp: Secretory carrier-associated membrane protein 4 from Arabidopsis with 82.05% of identity
• Blastx: Secretory carrier-associated membrane protein 4 from Arabidopsis with 82.05% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (AT1G32050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445255.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;